BioFusion Chems sells exclusively to clinics, laboratories, and other research facilities.

0

Cagrilintide Amylin Analog (5mg)

$170.00

Availability: In stock

Glass vial of Biolongevity Labs Cagrilintide Amylin Analog

Cagrilintide Peptide Structure

Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula: C194H312N54O59S2
Molecular Weight: 4409 g/mol
PubChem CID:  171397054
Synonyms:

  • 1415456-99-3
  • Cagrilintide [INN]
  • AO43BIF1U8
  • LDERDVMBIYGIOI-IZVMHKDJSA-N

Image showing Cagrilintide peptide structure

Source: PubChem

 

Weight 0.250 g
Dimensions 0.625 × 0.625 × 1.5 cm

Products

General

Info

BioFusionChems is a chemical supplier and is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act. BioFusionChems also is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic Act.

The products we offer are not intended to diagnose, treat, cure or prevent any disease. Our products are crafted for Laboratory/In-Vitro Experimental Use Only and are not formulated for human therapeutic use. BioFusionChems sells exclusively to clinics, laboratories, and other research facilities. Minimum order is $2,500.

The statements made within this website have not been evaluated by the US Food and Drug Administration.

© 2025, BioFusionChems. All Rights Reserved.